This is a working overview of Telomerase, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-05-04 and is reviewed periodically as new material appears.
Identity and purity of epitalon samples are normally established by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, combined with mass spectrometry. The mass spectrum confirms the expected molecular ion and can reveal truncated or oxidised by-products. Amino acid analysis after acid hydrolysis verifies that the four residues are present in the expected ratio. Certificates typically report a purity figure taken from chromatographic peak area, expressed as a percentage of total integrated signal.
Lyophilised epitalon is generally held at minus twenty degrees Celsius in a sealed container kept dry and dark. Cooler conditions are sometimes recommended for long-term archives. The solid takes up moisture readily enough that repeated opening of a vial introduces water, so dividing a batch into smaller portions before storage lowers degradation risk. Aqueous solutions are less durable than the dry powder and are usually prepared shortly before use, then kept cold and shielded from light to slow hydrolysis and oxidation.
Verification of research-grade material involves comparing a supplier chromatogram against an in-house reference, checking the observed mass against the calculated value, and where possible confirming residue order by tandem mass spectrometry or enzymatic peptide mapping. Purity claims should be read alongside the method used to obtain them, because detection wavelength and integration settings alter the result. Batch-specific data, rather than a generic grade statement, is the informative part of a certificate.
Regulatory status varies by country and is not harmonized. Epitalon is not an approved drug in major Western jurisdictions. In some countries it is sold as a research chemical, and in others it has appeared in products marketed for other categories. This inconsistent status means that purity, labeling accuracy, and documentation differ widely between suppliers, and verification of identity and purity through independent analysis is the usual way buyers assess a given lot.
Epitalon appears in the literature primarily through a small number of research groups, most of them associated with the St. Petersburg Institute of Bioregulation and Gerontology. Publications describe cell culture experiments, animal studies, and a limited number of small human studies. Independent replication outside this network is sparse. As a result, reviews of the topic usually separate descriptive reports of observed effects from the question of whether those effects generalize, and they note the difficulty of comparing studies that use different preparations and endpoints.
Analytical characterization of epitalon relies on standard peptide methods. Reverse-phase high-performance liquid chromatography is used to assess purity, and mass spectrometry confirms identity by checking the observed mass against the expected value near 390 daltons. Amino acid analysis can verify composition. Because the peptide is short and hydrophilic, it elutes early on many reverse-phase columns, so method development often requires ion-pairing reagents to achieve adequate retention and resolution from related impurities.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95 percent or higher by HPLC area | Higher grades are also offered |
| Primary analytical method | Reversed-phase HPLC, UV detection | Frequently paired with mass spectrometry |
| Confirmatory technique | Electrospray mass spectrometry | Observed mass compared with theory |
| Storage temperature | Minus 20 degrees Celsius, dry powder | Sealed, desiccated, protected from light |
| Solution handling | Prepare fresh before use | Hydrolysis proceeds in aqueous media |
Epitalon emerged from research conducted in Saint Petersburg by Vladimir Khavinson and colleagues, who studied short peptides as potential regulators of aging. The work built on epithalamin, a pineal gland extract reported to influence neuroendocrine function. Epitalon was designed as a synthetic counterpart with a defined sequence, allowing reproducible experiments that extracts could not support. Early publications described effects on melatonin rhythms and lifespan in animal models. These findings circulated mainly in Russian-language journals during the 1990s, which limited their visibility among English-speaking researchers.
The most widely cited claim is that epitalon activates telomerase and thereby extends telomere length. Supporting evidence comes largely from cultured human cells, where treatment was associated with increased telomerase activity and delayed replicative senescence. Telomerase activation is a biologically consequential effect, since the enzyme is largely silenced in most somatic cells. However, the route by which a short peptide would reach and act on the enzyme's regulatory machinery has not been established. Independent replication in human trials is scarce, so the link between cell-culture observations and whole-body aging remains an open question.
Human data are limited to small studies, often without the randomization, blinding, or control groups expected in contemporary clinical research. Reported outcomes have included changes in melatonin levels, immune markers, and subjective measures, but sample sizes were generally too small to support firm conclusions. Some reviews treat the peptide as promising while noting methodological weaknesses; others question whether the observed effects are specific. The compound is frequently discussed in longevity-focused communities, where enthusiasm often outpaces the published evidence. Separating established findings from speculation is therefore important when reading summaries of this research.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Peptides of this size are generally stable as dry solids but degrade in solution over time. The principal routes are hydrolysis of the peptide backbone and oxidation, with hydrolysis favoured by elevated temperature and extreme pH. Aqueous solutions held at room temperature can show measurable loss of purity within days, while frozen aliquots are considerably more durable. Because the sequence contains neither cysteine nor methionine, oxidation is less of a concern than for many other peptides, but pH control during handling still matters.
Typical storage for the lyophilized powder is −20 °C or lower, in a sealed container protected from light and moisture. Hygroscopic material should be allowed to equilibrate to room temperature before the vial is opened, which limits condensation on the contents. Working solutions are commonly divided into single-use aliquots and frozen to avoid repeated freeze-thaw cycles. Dilute solutions are more prone to adsorption onto plastic surfaces and to loss during filtration, so procedures that minimize transfers and use low-binding labware are preferable.
PIP2 domains (also called PIP2 clusters) are a type of cholesterol-independent lipid domain formed from phosphatidylinositol and positively charged proteins in the plasma membrane. They tend to inhibit GM1 lipid raft function. Phosphatidylinositol 4,5-bisphosphate (PIP2) is an anionic signaling lipid. Its polyunsaturated acyl chains exclude it from GM1 lipid rafts. The multiple negative charges on PIP2 are thought to cluster proteins with positive charges residing in the plasma membrane leading to nanoscale clusters. PIP3 is also clustered away from PIP2 and away from GM1 lipid rafts. PIP2 domains inhibit GM1 domain function by attracting palmitoylated proteins away from GM1 lipid rafts. For this to occur, a protein must be both palmitoylated and bind PIP2. Presumably PIP2 could also antagonize PIP3 localization but this has not been shown directly.
Public health laboratories operate as a first line of defense to protect the public against diseases and other health hazards. Day-to-day operations range from testing water and food, checking for toxins in soil, and investigating new strains of infectious diseases, such as COVID-19 or Ebola. Every US state and territory, and the District of Columbia, has a central governmental public health laboratory that performs testing and other laboratory services on behalf of the entire jurisdiction. In addition, some states have local public health laboratories ranging in size from large metropolitan laboratories with over a hundred scientists to small rural laboratories with one or two staff that support local public health.
Aminoacyl-tRNA synthetase enzymes consume ATP in the attachment tRNA to amino acids, forming aminoacyl-tRNA complexes. Aminoacyl transferase binds AMP-amino acid to tRNA. The coupling reaction proceeds in two steps: aa + ATP ⟶ aa-AMP + PPi aa-AMP + tRNA ⟶ aa-tRNA + AMP The amino acid is coupled to the penultimate nucleotide at the 3′-end of the tRNA (the A in the sequence CCA) via an ester bond (roll over in illustration). Transporting chemicals out of a cell against a gradient is often associated with ATP hydrolysis. Transport is mediated by ATP binding cassette transporters. The human genome encodes 48 ABC transporters, that are used for exporting drugs, lipids, and other compounds.
It might occur either at the enzyme or receptor level. There are two possible outcomes at the enzyme level: competitive inhibition or enzyme activity reactivation. Ethyl alcohol or fomepizole used in methyl alcohol or ethylene glycol poisoning is a typical example of competitive enzyme inhibition. By posing competition for alcohol dehydrogenase (ADH) with methyl alcohol and ethylene glycol, these drugs reduce the production of harmful metabolites. For receptor level, the traditional antidotes include naloxone and flumazenil. Flumazenil functions as a competitive antagonist at the GABA-A receptor complex's benzodiazepine site. By doing this, the CNS and respiratory depression would reverse and the inward chloride current would reduce. Flumazenil is useful in treating and preventing benzodiazepine-induced coma from recurring.
Sources: en.wikipedia.org
pcALCL is the second most common lymphoma in the category of Cutaneous T cell lymphoma cutaneous T cell lymphomas that includes lymphomatoid papulosis, various borderline CD30-positive cutaneous T cell lymphomas, and mycosis fungoides. The median age at diagnosis for pcALC is 61 years. The disease has a male predominance and appears to be more common in Caucasian populations. Individuals with pcALCL typically present with reddish masses that initially appear in the skin or, much less frequently, the lymph nodes or various organs. These masses are nodules or tumors that are often ulcerated, greater than 2 cm in diameter, and localized to a single site. In 20% of cases, however, they occur in multiple sites. In about 10% cases followed for many years, pcALCL presenting as skin lesions progresses to extracutaneous sites, mainly to regional draining lymph nodes. Over these same long periods, however, the disease's lesions partially regress in about 50% of cases but then relapse in about 40% of cases.
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
The usual approach is reversed-phase HPLC with ultraviolet detection, reported as a percentage of total peak area. Mass spectrometry is used alongside chromatography to confirm identity rather than purity alone.
The dry powder is commonly kept at minus twenty degrees Celsius, desiccated and away from light. Solutions are generally prepared fresh because they break down faster than the solid form.
Tandem mass spectrometry or enzymatic peptide mapping can establish residue order. A single intact mass value indicates composition and molecular weight but not always the precise arrangement of residues.
Identity is normally confirmed by mass spectrometry, which checks the measured mass against the expected value near 390 daltons. Reverse-phase high-performance liquid chromatography is used alongside it to assess purity. Amino acid analysis can provide additional composition data.