If you have been reading about lyophilised powder and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-09-14. Where a claim depends on a specific study, the study is described rather than over-claimed.
Storage practice centres on limiting moisture, oxygen, and repeated temperature cycling. Freeze-dried powder is generally held desiccated at minus twenty degrees Celsius or colder and protected from light. Reconstituted solutions are markedly less stable, and the aspartate-glycine junction is prone to succinimide formation at neutral to mildly alkaline pH. Portioning material into single-use aliquots reduces degradation compared with repeated freeze-thaw cycles. Stability data specific to this tetrapeptide remain scarce, so most handling guidance is extrapolated from general peptide chemistry rather than measured directly.
Documentation accompanying research peptides usually includes a certificate of analysis listing the batch number, purity figure, and test methods applied. Buyers comparing suppliers should check whether the reported purity refers to chromatographic area or to a mass-balance calculation, because the two are not equivalent. Counter-ion content, residual solvents, and water content are sometimes omitted from such certificates even though they affect the actual peptide mass present. Independent verification through a second laboratory is the most direct way to confirm that a supplied material matches its label.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
Several names circulate for the same molecule, including epitalon, epithalone, epithalamin tetrapeptide, and the sequence code AEDG. A CAS registry number, 307297-39-8, is commonly cited for it, though catalogue entries should be checked against supplier documentation because mislabelled records occur. In its usual form the peptide carries free amino and carboxyl termini and is neither glycosylated nor lipidated. Researchers distinguish the defined tetrapeptide from epithalamin itself, a crude pineal preparation containing many peptides that is not chemically characterised.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Freeze-dried solid |
| Solubility class | Freely soluble in water | Aqueous buffers also suitable |
| Typical storage temperature | Minus 20 degrees Celsius or colder | Desiccated and light protected |
| Typical analytical method | RP-HPLC with UV detection | 214 nm on C18 column |
| Identity confirmation | Electrospray mass spectrometry | Sequence verified separately |
Identity is normally established by reversed-phase high-performance liquid chromatography combined with mass spectrometry, a pairing that separates components and confirms molecular mass at once. Purity is quoted as a percentage from the chromatogram, and figures above ninety-five percent are a frequent commercial specification. Amino acid analysis or sequencing supplies further confirmation when required. Because many short peptides behave similarly under chromatography, retention time alone does not establish sequence; the mass measurement is what separates one tetrapeptide from another, and certificates should report both.
Short peptides such as AEDG are normally supplied as a freeze-dried solid and are kept dry, cold, and shielded from light. Holding at minus twenty degrees Celsius is common for the long term, while a refrigerator suffices for brief periods before use. The material takes up moisture to some degree, so containers should stay sealed and be allowed to reach room temperature before opening, which limits condensation on the contents. Repeated warming and cooling of a single container is discouraged because it admits water and can lower the amount of intact peptide.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
In World War I Calabria dispatched five brigades to the effort, most notably the Catanzaro Brigade. It was formed of the 141st and 142nd regiments, composed almost exclusively of Calabrians. It was one of the units most committed by the Royal Army in the war. Part of the Third Army under the command of the king's cousin the Duke of Aosta, it participated in the Third Battle of the Isonzo, where, on Monte San Michele, between 17 and 26 October 1915, it lost almost half of its personnel (about 6,000 men). In addition, during the Strafexpedition of June 1916, the 141st Brigade Regiment lost 38% of its components, with 333 casualties.
== Reception == John Schwarz of Bubbleblabber gave the episode an 8/10, calling it "one of the more movie-parody efforts" and remarked that: "Not since The Imaginationland Trilogy has Trey Parker dipped into this bag of tricks to truly go nuts by integrating fantastical elements, like a crew of pissed off breakfast cereal mascots, into the plot of the show and does so in such hysterical fashion." Renaldo Matadeen writing for CBR felt that the episode "speaks to another real-world issue, where bodies like the FDA and other authorities warn against such secondary pharmacies." Author Cathy O'Neil wrote that it "brilliantly satirizes the culture around weight loss, fat shaming, and weight loss drugs". Rapper Lizzo, who is referenced in the episode, reacted in a video post on Instagram, "Guys, my worst fear has been actualized. I've been referenced in a South Park episode."
This caused another rapid expansion, particularly in Germany. Between 1877 and 1887, 130 German patents for azo dyes were filed and 105 new dyes made it to market. It also lead to a difference in how chemical companies interacted with consumers. German dye firms developed in-house marketing and distribution capabilities coordinated directly with their research and development departments. Paul Schützenberger, in response to what he had seen at the 1878 Universal Exposition commented, "The abundance, the variety of combinations is such that we do not know whether to be more amazed by their multiplicity or by the imagination required to name them. Indeed, it is by the thousands that dyers create, every season, new colors for their sample cards." Professional societies based on the synthetic dye industries began to form. By the First World War, the largest number of dyes sold in the market fell into the class of azo dyes. 1885, an azo-naphthol, Para-red, became the first water-insoluble organic pigment not containing acidic or basic groups.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
The Apex bank stated that all transactions conducted through correspondent banking relationships shall be managed with a risk-based approach and Know Your Correspondent procedures, this is to ascertain whether the bank or financial institution is regulated by a money laundering prevention body. The correspondent is to take action to identify the customer. The CBN also released a guidance note named; Anti–money Laundering/combating the financing of terrorism (AML/CFT) for OFIs. The CBN Financial Policy and Regulation Director Chibuzo Efobi mentioned that the guidance note would enable the sub-sector to identify, assess and minimize the risks of terrorist financing and money laundering. He also said that this Guidance note would identify risk management procedures that would lessen the vulnerability of financial institutions to Money laundering schemes.
Sources: en.wikipedia.org
Nayib Armando Bukele Ortez (born 24 July 1981) is a Salvadoran politician who has served as the 43rd president of El Salvador since 2019. In 1999, Bukele established an advertising company and worked at another owned by his father, Armando Bukele Kattán. Both companies advertised election campaigns for the Farabundo Martí National Liberation Front (FMLN) political party. Bukele entered politics in 2011. In 2012, he joined the FMLN and was elected mayor of Nuevo Cuscatlán. Bukele served until his 2015 election as Mayor of San Salvador, where he served until 2018. In 2017, Bukele was ousted from the FMLN. He founded the Nuevas Ideas political party shortly afterward and pursued a presidential campaign in 2019. After the Supreme Electoral Court (TSE) refused to register his party, Bukele ran for president with the Grand Alliance for National Unity (GANA) and won with 53 percent of the vote. In July 2019, Bukele implemented the Territorial Control Plan to reduce El Salvador's 2019 homicide rate of 38 per 100,000 people. Homicides fell by 50 percent during Bukele's first year in office. After 87 people were killed by gangs over one weekend in March 2022, Bukele initiated a nationwide crackdown on gangs, resulting in the arrests of over 85,000 people with alleged gang affiliations by December 2024. El Salvador's homicide rate officially decreased to 1.9 homicides per 100,000 in 2024, one of the lowest in the Americas, although the factual accuracy has been contested.
=== Eli Vance === Dr. Eli Vance (voiced by Robert Guillaume in Half-Life 2 and its episodes and by James Moses Black in the prequel Half-Life: Alyx) is a physicist, researcher, and Harvard University graduate who worked with Gordon Freeman at Black Mesa. He wears a prosthetic that replaces his left leg beneath the knee, which was lost when he was attacked by a Bullsquid while helping Dr. Isaac Kleiner climb over a wall into a Combine city; this is not from any canon sources yet many fans and Marc Laidlaw, the story writer of the Half-Life franchise, have since accepted it. He is Alyx Vance's father; his late wife, Azian, died in the aftermath of the resonance cascade. The leader of the Lambda Resistance, Dr. Vance was the first human being to make peaceful contact with the Vortigaunt species and thus the "first collaborator", quickly persuading the alien race to ally with humanity against the Combine invasion of Earth. In Episode Two, Eli Vance works at the White Forest base before being killed by a Combine Advisor. The 2020 VR game Half-Life: Alyx, which takes place between the events of Half-Life and Half-Life 2, focuses on Eli and Alyx Vance as they fight against the Combine's occupation of Earth. As a result of the events of the game, his death is prevented, albeit at the cost of his daughter Alyx becoming an unwilling agent of the G-Man. Upon learning the truth, Eli seeks to rescue her.
== Hormone and Metabolic Modulators == Hormone and metabolic modulators modify the effects of hormones or accelerate or slow down enzyme reactions, for example anti-Estrogens are substances that block the effects of estrogen in the body (usually to prevent tumors) and are used by athletes to counter the side effects of steroids. Anti-estrogens are clinically used in the treatment of breast cancer and to reduce the breast cancer incidence in high-risk women. Examples of anti-estrogens and other hormone and metabolic modulators are: anastrozole, clomiphene, tamoxifen, raloxifene, and formestane.
Gender inequalities in France affect several areas, including family life, education, employment, health, and political participation. The United Nations Development Programme (UNDP) monitors gender disparities through the Gender Inequality Index (GII), which evaluates reproductive health, empowerment, and labor market participation.
SJS, like TEN and erythema multiforme, is characterized by confluent epidermal necrosis with minimal associated inflammation. The acuity is apparent from the (normal) basket weave-like pattern of the stratum corneum.
Sources: en.wikipedia.org
=== Human use === Nitrofurazone was previously available as a prescription in the U.S., and was indicated as a topical solution, topical cream, or topical ointment for the treatment of bacterial skin infections, wounds, burns, and ulcers. It was also used as a prophylactic measure to prevent infection that could potentially result in skin graft rejection. Nitrofurazone is still very popular as a topical solution for the treatment of tonsillitis in Russia.
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing spikes in blood glucose levels after a meal. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin.
Some mutations of SNX8 have been related to certain types of cancer, specially to stomach and endometrial cancer. The bar plot on the right shows the proportion of tumor samples from 15 cancer types that have any kind of altering mutations in the given protein. Moreover, some studies seem to draw an important relationship between different type of cancers and SNX8 expression; although most of the patients with colorectal, stomach or testis cancer showed high levels of SNX8, almost any patient with prostate, endometrial or carcinoid cancer presented low or any concentrations of SNX8. The rationale behind this differential phenotype of SNX8 synthesis remains unclear.
The Pearl Index, also called the Pearl rate, is the most common technique used in clinical trials for reporting the effectiveness of a birth control method. It is a very approximate measure of the number of unintended pregnancies in 100 woman-years of exposure that is simple to calculate, but has a number of methodological deficiencies. The index was introduced by Raymond Pearl in 1934. It has remained popular for over eighty years, in large part because of the simplicity of the calculation. Several kinds of information are needed to calculate a Pearl Index for a particular study: the total number of months or cycles of exposure by women in the study the number of pregnancies the reason for leaving the study (pregnancy or other reason) There are two calculation methods for determining the Pearl Index:
There is only one viral toxin that has been described so far: NSP4 from rotavirus. It inhibits the microtubule-mediated secretory pathway and alters cytoskeleton organization in polarized epithelial cells. It has been identified as the viral enterotoxin based on the observation that the protein caused diarrhea when administered intraperitoneally or intra-ileally in infant mice in an age-dependent manner. NSP4 can induce aqueous secretion in the gastrointestinal tract of neonatal mice through activation of an age- and Ca2+-dependent plasma membrane anion permeability.
Sources: en.wikipedia.org
Reversed-phase high-performance liquid chromatography with ultraviolet detection at 214 nanometres is the usual approach. Peak area percentage provides a purity figure relative to other components in the sample. Mass spectrometry is then applied to confirm identity.
Aspartate can cyclise into a succinimide intermediate that later hydrolyses back as isoaspartate. Both forms share the same molecular mass, so mass spectrometry alone cannot tell them apart. This shapes how purity data should be interpreted.
Freeze-dried material is normally kept desiccated below minus twenty degrees Celsius and shielded from light. Solutions are prepared shortly before use and held cold. Repeated thawing is avoided because it accelerates aggregation and degradation.
It is a synthetic tetrapeptide. Its sequence was derived from research on peptide fractions of bovine pineal extract, and the intact AEDG sequence has not been demonstrated as an abundant free peptide in human tissue.